Description For your second assignment, you are required to modify the HTML code of an existing Responsive Design tutorial website that utilizes responsive design. I have attached the instructions and the html file that need to be modified. Let me know if you have issues with the file or need any thing more.

PROSITE (http://au.expasy.org/prosite/) is a database of protein domains, families and functional sites. Each PROSITE record is often associated with a pattern or profile to describe the protein domain or functional site. Please look at the record of PDOC00300 (http://prosite.expasy.org/PDOC00300) which is a GATA-type zinc finger domain that binds to DNA sites with the consensus sequence (A/T)GATA(A/G). This type of “zinc finger” domains consist of a consensus sequence of C-x2-C-x17-C-x2-C , which means one Cys, two any amino acids, one Cys, 17 any amino acids, one Cys, two any amino acids, and one Cys.Please use this consensus sequence, and write an equivalent regular expression pattern. 1) Record the regular expression pattern below: 2) Please develop a Java program that uses this regular expression pattern to search through a FASTA format file containing more than 300 protein sequences and all contain the “zinc finger” in their title lines, but not all of them contain this pattern in their sequences. In the output of the program, print out the title line, the position of the pattern in the sequence, and followed by the sequence itself. Here is the protein sequence file zincFinger.txt. Below is part of a sample output of the program: >gi|116268103|ref|NP_001070736.1| zinc finger FYVE domain-containing protein 19 [Homo sapiens] contains the zinc finger site: CSGCLSFSAAVPRTGNTQQKVCKQCat locations:103 128MNYDSQQPPLPPLPYAGCRRASGFPALGRGGTVPVGVWGGAGQGREGRSWGEGPRGPGLGRRDLSSADPAVLGATMESRCYGCAVKFTLFKKEYGCKNCGRAFCSGCLSFSAAVPRTGNTQQKVCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWSLEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYRLPDSDDDEDEETAIQRVLQQLTEEASLDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH 3) Please modify the above print out of the sequence to include a label underneath the zinc finger consensus sequence. See below the sample output. (2 points)  >gi|116268103|ref|NP_001070736.1| zinc finger FYVE domain-containing protein 19 [Homo sapiens] contains the zinc finger site: CSGCLSFSAAVPRTGNTQQKVCKQC at locations: 103 128 MNYDSQQPPLPPLPYAGCRRASGFPALGRGGTVPVGVWGGAGQGREGRSW   GEGPRGPGLGRRDLSSADPAVLGATMESRCYGCAVKFTLFKKEYGCKNCG   RAFCSGCLSFSAAVPRTGNTQQKVCKQCHEVLTRGSSANASKWSPPQNYK   *************************  KRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIE   ARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQA   QQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWS   LEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYR   LPDSDDDEDEETAIQRVLQQLTEEASLDEASGFNIPAEQASRPWTQPRGA   EPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHD   AFELKEHQTSAYSPPRAGQEH  

1)The largest source of bugs in software arise from software specifications. Which of the following is not a software specification related bug? Group of answer choices a)The software has bugs because the prepared requirements document was difficult for the developers to comprehend b)The software has bugs because the developers documented the source code c)The software has bugs because the requirements engineer could not keep up with frequent changes demanded by the customer d)The software has bugs because the requirements engineer accidentally omitted some specifications during elicitation 2)Which terms when used refer to software failures Group of answer choices Variance, Bug, Contention, Inconsistency Bug, Anomaly, Matter, Defect Failure, Incident, Bug, Contention All the answers are correct 3)During the software development process, the cost of detecting bugs increases when a bug makes it into the next stage of the development life cycle. Which of the following the correct life cycle for bug detection with respect to increasing cost? Group of answer choices Specification, Design, Test, Code Specification, Design, Code, Test Specification, Code, Design, Test Specification, Code, Test, Design 4)Which of the following are traits of a good software tester? Group of answer choices Indolent, Persuasive Diplomatic, Considerate Relentless, Slothful Lethargic, Perfectionist 5)Which of the following is not a task executed during software development Group of answer choices a)Teams of people that play different roles b)Specifics of how people interact and their tasks c)Routine software maintenance d)Schedules for implementing tasks and managing resources 6)Which of the following is the correct definition for verification in software testing? Group of answer choices a)the process of determining that developers have built the right software b)the process where the developers assure the client that they built right software c)the process of that tested software meets the customer’s specifications d)the process of measuring the closeness of measured values to known standards in software 7)The following are true about black-box testing except: Group of answer choices a)The software tester does not know why the software works the way it does b)The software tester knows the underlying algorithm and inner working of the software c)The software tester knows what the software does d)The software tester knows the expected output from software for a every given set of input 8)Which of the following tool(s) can be used to collect customer requirements during the software development process? Group of answer choices a)All the answers are correct b)Surveys c)Focus groups d)Evaluations of previous software versions 9)Design documents are of one of the categories of deliverables in software development. Which of the following best describes state transition diagrams? Group of answer choices a)Show how data moves through the various software components b)Describe overall software design c)Describe how software components interact with each other d)break down the system into conditions and describe system behavior 10)Which of the following best describes a test plan? Group of answer choices a)A progress report made when testing software b)A method for verifying that software meets customer needs c)Documentation of test tools which are purchased or developed in-house d)A plan on strategies for inducing and detecting bugs in software 11)Which of the following statements is FALSE: Group of answer choices a)As a software tester, you have adequate time to test all aspects of the software b)As a software tester, you never test every aspect of the software c)As a software tester, you never have sufficient time to test all aspects of the software d)As a software tester, you never be given detailed software specifications 12)The attribute(s) of quality software include the following except Group of answer choices a)Reliability b)Scalability c)Usability d)Survivability 13)Which of the following activities is not performed during static white-box testing? Group of answer choices a)Examining and reviewing test cases b)Examining and reviewing test scripts c)Examining and reviewing test plans d)Examining and running test scripts 14)A program statement is an inbuilt module in a computer program that processes data Group of answer choices a)True b)False