Writing lab report for Fundamental of Communication class.

Anonymous
timer Asked: Oct 18th, 2018
account_balance_wallet $25

Question Description

Hello everyone, I have lab report for Fundamental of Communication lab so I want someone good in writing and electrical engineering to do it. I did the lab and I took screenshot of the important steps. I want him or her to write Introduction, conclusion and explain of what i did after each of the screenshots in few sentences. I attached the lab manual and the what i did in the lab. IT IS EXPERIMENT NUMBER 6 IN THE LAB MANUAL

Unformatted Attachment Preview

Emona DATEx Lab Manual Volume 1 Experiments in Modern Analog & Digital Telecommunications For NI™ ELVIS II Barry Duncan . Emona DATEx Lab Manual Volume 1 Experiments in Modern Analog & Digital Telecommunications For NI™ ELVIS II Barry Duncan Emona DATEx Lab Manual for NI™ ELVIS II Volume 1 Experiments in Modern Analog and Digital Telecommunications. Author: Barry Duncan Technical editors: Tim Hooper & Carlo Manfredini Issue Number: 3.1 Published by: Emona Instruments Pty Ltd, 78 Parramatta Road Camperdown NSW 2050 AUSTRALIA. web: www.emona-tims.com telephone: +61-2-9519-3933 fax: +61-2-9550-1378 Copyright © 2007 - 2011 Emona Instruments Pty Ltd and its related entities. All rights reserved. No part of this publication may be reproduced, translated, adapted, modified, edited or distributed in any form or by any means, including any network or Web distribution or broadcast for distance learning, or stored in any database or in any network retrieval system, without the prior written consent of Emona Instruments Pty Ltd. For licensing information, please contact Emona Instruments Pty Ltd. DATEx™ is a trademark of Emona TIMS Pty Ltd. LabVIEW™, National Instruments™, NI™, NI ELVIS™, and NI-DAQ™ are trademarks of National Instruments Corporation. Product and company names mentioned herein are trademarks or trade names of their respective companies. Printed in Australia Contents Introduction ...........................................................................................................i – iv How to install and power up DATEx™ for NI ELVIS II/+ ................ v How to install and power up DATEx™ for NI ELVIS I ...................... vii ESD Warning, Unpacking, Handling, Set-up and ESD Preventative Measures.............................................................. ix 1 - An introduction to the NI ELVIS II test equipment.............................. Expt 1 - 1 2 - An introduction to the DATEx experimental add-in module................ Expt 2 - 1 3 - An introduction to soft front panel control .............................................. Expt 3 - 1 4 - Using the Emona DATEx to model equations............................................. Expt 4 - 1 5 - Amplitude modulation (AM)............................................................................. Expt 5 - 1 6 - Double Sideband (DSBSC) modulation......................................................... Expt 6 - 1 7 - Observations of AM and DSBSC signals in the frequency domain ..... Expt 7 - 1 8 - AM demodulation................................................................................................ Expt 8 - 1 9 - Double Sideband DSBSC demodulation ....................................................... Expt 9 - 1 10 - Single Sideband (SSB) modulation & demodulation............................... Expt 10 - 1 11 - Frequency Modulation (FM) ........................................................................... Expt 11 - 1 12 - FM demodulation............................................................................................... Expt 12 - 1 13 - Sampling & reconstruction ............................................................................ Expt 13 - 1 14 - PCM encoding ..................................................................................................... Expt 14 - 1 15 - PCM decoding ..................................................................................................... Expt 15 - 1 16 - Bandwidth limiting and restoring digital signals..................................... Expt 16 - 1 17 - Amplitude Shift Keying (ASK) ..................................................................... Expt 17 - 1 18 - Frequency Shift Keying (FSK)...................................................................... Expt 18 - 1 19 - Binary Phase Shift Keying (BPSK)............................................................... Expt 19 - 1 20 - Quadrature Phase Shift Keying (QPSK) .................................................. Expt 20 - 1 21 - Spread Spectrum - DSSS modulation & demodulation ........................ Expt 21 - 1 22 - Undersampling in Software Defined Radio.............................................. Expt 22 - 1 Electrostatic Discharge Sensitive Product CAUTION: The inputs/outputs of this product can be damaged if subjected to Electrostatic Discharge (ESD). To prevent damage, industry-standard ESD prevention measures must be employed during installation, maintenance, and operation. ,QWURGXFWLRQ 7KH(77'$7([Œ/DE0DQXDO2YHUYLHZ 7KH(77/DE0DQXDO9ROXPH2QHFRYHUVDEURDGUDQJHRILQWURGXFWRU\GLJLWDODQGDQDORJ WHOHFRPPXQLFDWLRQVWRSLFVWKURXJKDVHULHVRIFDUHIXOO\SDFHGKDQGVRQODERUDWRU\ H[SHULPHQWV(DFKH[SHULPHQWLVZULWWHQWRVXSSRUWWKHWKHRUHWLFDOFRQFHSWVLQWURGXFHGLQWKH FODVVZRUNRIDILUVWFRXUVHLQPRGHUQWHOHFRPPXQLFDWLRQV  (DFK'$7([H[SHULPHQWSUHVHQWVDQLQWHUHVWLQJKDQGVRQOHDUQLQJH[SHULHQFHIRUWKHVWXGHQW,Q HDFKH[SHULPHQWWKHVWXGHQWLVFKDOOHQJHGWREXLOGPHDVXUHDQGFRQVLGHUWKHUHDUHQR´LQVWDQWµ RU´FRRNERRNVW\OHµH[SHULPHQWV'$7([LVDFWXDOO\DWUXHHQJLQHHULQJPRGHOLQJV\VWHPZKHUH VWXGHQWVVHHWKDWWKHEORFNGLDJUDPVVRFRPPRQLQWKHLUWH[WERRNVUHSUHVHQWUHDOIXQFWLRQLQJ V\VWHPV    (TXLSPHQW5HTXLUHG 7KH(PRQD'$7([$GGLQ0RGXOH KDVDFROOHFWLRQRIEORFNV FDOOHG PRGXOHV WKDWDUHSDWFKHG WRJHWKHUWRLPSOHPHQWGR]HQVRI WHOHFRPPXQLFDWLRQVH[SHULPHQWV    ([SHULPHQWVPDNHXVHRIWKH(PRQD'$7([WHOHFRPPXQLFDWLRQVWUDLQHUNLWWRJHWKHUZLWKWKH1, (/9,6,RU,,SODWIRUPDQG1,/DE9,(:UXQQLQJRQD3&7KHIXQFWLRQDOLW\DQGUDQJHRIWKH YLUWXDOLQVWUXPHQWDWLRQDYDLODEOHGHSHQGVRQWKH1,'$4WKDWLVFRXSOHGZLWK1,(/9,6, SODWIRUP(/9,6,,KDVDOOQHFHVVDU\LQWHUIDFLQJFLUFXLWU\EXLOWLQWRLW  5HIHUWRWKH(77'$7([86(50$18$/IRUIXUWKHUGHWDLOVDVZHOODVLQIRUPDWLRQRQWKH LQVWDOODWLRQDQGXVHRIWKH'$7([1,(/9,6H[SHULPHQWV\VWHP  6WXGHQW$FDGHPLF/HYHO ([SHULPHQWVLQWKLVYROXPHKDYHEHHQSUHSDUHGIRUVWXGHQWVZLWKRQO\DEDVLFNQRZOHGJHRI PDWKHPDWLFVDQGDOLPLWHGEDFNJURXQGLQSK\VLFVDQGHOHFWULFLW\  6WXGHQWVZLWKDKLJKHUOHYHORIFRPSHWHQFHLQPDWKHPDWLFVZLOODOVRJDLQDGHHSHUXQGHUVWDQGLQJ RIWHOHFRPPXQLFDWLRQVWKHRU\E\XVLQJWKH'$7([V\VWHP'XHWRWKHHQJLQHHULQJ´PRGHOLQJµ QDWXUHRIWKH'$7([V\VWHPWKH\ZLOOEHDEOHWRLQYHVWLJDWHPRUHFRPSOH[LVVXHVFDUU\RXW DGGLWLRQDOPHDVXUHPHQWVDQGWKHQFRQWUDVWWKHLUILQGLQJVWRWKHLUWKHRUHWLFDOXQGHUVWDQGLQJDQG PDWKHPDWLFDODQDO\VLV  ,QWURGXFWLRQ‹(PRQD,QVWUXPHQWV3W\/WG i 'LGDFWLFSKLORVRSK\EHKLQGWKH(77'$7([Œ6\VWHP ²(PRQD7,06ŒDQGWKH´%ORFN'LDJUDPµDSSURDFK   7KH(PRQD'$7([WHOHFRPPXQLFDWLRQVWUDLQHUGUDZVRQDZHOOHVWDEOLVKHGH[SHULPHQWDO PHWKRGRORJ\WKDWEULQJVWROLIHWKH´XQLYHUVDOODQJXDJHµRIWHOHFRPPXQLFDWLRQVWKH%/2&. ',$*5$02ULJLQDOO\GHYHORSHGLQWKH·VE\7LP+RRSHUDVHQLRUOHFWXUHULQ WHOHFRPPXQLFDWLRQVDW7KH8QLYHUVLW\RI1HZ6RXWK:DOHV$XVWUDOLDDQGIXUWKHUGHYHORSHGE\ (PRQD,QVWUXPHQWV(PRQD7,06ŒRU´7HOHFRPPXQLFDWLRQV,QVWUXFWLRQDO0RGHOLQJ6\VWHPµLV XVHGE\WKRXVDQGVRIVWXGHQWVDURXQGWKHZRUOGWRLPSOHPHQWSUDFWLFDOO\DQ\IRUPRI PRGXODWLRQRUFRGLQJ  %ORFN'LDJUDPV %ORFNGLDJUDPVDUHXVHGWRH[SODLQWKHSULQFLSOHRI  RSHUDWLRQRIHOHFWURQLFV\VWHPV OLNHDUDGLRWUDQVPLWWHU IRUH[DPSOH ZLWKRXWZRUU\LQJDERXWKRZWKHFLUFXLW ZRUNV(DFKEORFNUHSUHVHQWVDSDUWRIWKHFLUFXLWWKDW SHUIRUPVDVHSDUDWHWDVNDQGLVQDPHGDFFRUGLQJWRZKDW LWGRHV([DPSOHVRIFRPPRQEORFNVLQFRPPXQLFDWLRQV HTXLSPHQWLQFOXGHWKHDGGHUPXOWLSOLHURVFLOODWRUDQGVR $W\SLFDOWHOHFRP·V%/2&.',$*5$0 RQ  7KH7,06ŒDQGKHQFH'$7([ŒDSSURDFKWRLPSOHPHQWLQJWHOHFRPPXQLFDWLRQVH[SHULPHQWV WKURXJKUHDOL]LQJ%/2&.'$,$*5$06KDVWKHIROORZLQJEHQHILWVLQWKHHGXFDWLRQDOHQYLURQPHQW  • 6WXGHQWVJDLQSUDFWLFDOH[SHULHQFHZLWKWUXHPDWKHPDWLFDOPRGHOLQJKDUGZDUHGHVLJQHG VSHFLILFDOO\IRULPSOHPHQWLQJWHOHFRPPXQLFDWLRQVWKHRU\ • 6WXGHQWVDFWXDOO\EXLOGHDFKH[SHULPHQWVWDJHE\VWDJHLQDQHQJLQHHULQJPDQQHUE\ IROORZLQJWKH%/2&.',$*5$0 • 6WXGHQWVDUHIUHHWRWU\´ZKDWLIµVFHQDULRVWRYDOLGDWHWKHLUXQGHUVWDQGLQJRIWKHWKHRU\ EHLQJLQYHVWLJDWHGE\YLHZLQJUHDOUHDOWLPHHOHFWULFDOVLJQDOV • '$7([LVGHVLJQHGWRDOORZVWXGHQWVWRPDNHPLVWDNHVKHQFHVWXGHQWVZLOOOHDUQIURP WKHLUKDQGVRQH[SHULHQFHVDVWKH\LQYHVWLJDWHWKHLUILQGLQJV  2QHWR2QH5HODWLRQVKLS 7KHILJXUHRQWKHULJKWLOOXVWUDWHVWKHRQH WRRQHUHODWLRQVKLSEHWZHHQHDFKEORFNRI WKH%/2&.',$*5$0DQGWKHLQGHSHQGHQW IXQFWLRQDOFLUFXLWEORFNVRIWKH'$7([ WUDLQHUERDUG  7KHIXQFWLRQDOEORFNVRIWKH'$7([ERDUG DUHXVHGDQGUHXVHGLQH[SHULPHQWVMXVW DVEORFNVRIWKHEORFNGLDJUDPUHDSSHDULQ PDQ\GLIIHUHQWLPSOHPHQWDWLRQV   ([DPSOHVRI'$7([ŒIXQFWLRQDOEORFNV LL  ‹(PRQD,QVWUXPHQWV3W\/WG,QWURGXFWLRQ 1,/DE9,(:ŒDQG'$7([Œ 7KH(PRQD'$7([DGGLQPRGXOHLVIXOO\LQWHJUDWHGZLWKWKH1,(/9,6SODWIRUPDQG1,/DE9,(: HQYLURQPHQW$OO'$7([ŒNQREVDQGVZLWFKHVFDQEHYDULHGHLWKHUPDQXDOO\RUXQGHUWKHFRQWURO 1,/DE9,(:9,V  '$7([Œ9,VDUHSURYLGHGLQWKH'$7([NLWVRWKDWWKHVWXGHQWKDVWKHDELOLW\IXUWKHUHQKDQFH WKHH[SHULPHQWFDSDELOLWLHVRIWKH'$7([KDUGZDUHE\XWLOL]LQJWKHUHVRXUFHVRI1,/DE9,(: DQGHYHQLQWHJUDWLRQZLWK1,·VZLGHUDQJHRI5)SURGXFWV  *XLGHOLQHVIRU8VLQJWKH/DE0DQXDO  7KHH[SHULPHQWVLQWKLVYROXPHKDYHEHHQSUHSDUHGIRUVWXGHQWVZLWKRQO\DEDVLFNQRZOHGJHRI PDWKHPDWLFV+RZHYHUGXHWRWKHHQJLQHHULQJ´PRGHOLQJµQDWXUHRIWKH'$7([DGGLQPRGXOH VWXGHQWVZLWKDKLJKHUOHYHORIFRPSHWHQFHLQPDWKHPDWLFVZLOOHTXDOO\JDLQDGHHSHU XQGHUVWDQGLQJRIWHOHFRPPXQLFDWLRQVWKHRU\E\FDUU\LQJRXWWKHVHH[SHULPHQWV  7KHFKDSWHUVFRYHUDEURDGUDQJHRIWHOHFRPPXQLFDWLRQVFRQFHSWVIURPIXQGDPHQWDOWRSLFV IDPLOLDUWRDOOVWXGHQWVVXFKDV$0DQG)0EURDGFDVWLQJWKURXJKWRWKHXQGHUO\LQJWHFKQRORJLHV XVHGLQWKHODWHVWPRELOHWHOHSKRQHVDQGZLUHOHVVV\VWHPV,QHDFKH[SHULPHQWWKHFRUH WHFKQRORJ\LVUHYHDOHGWRWKHVWXGHQWDWLWVPRVWIXQGDPHQWDOOHYHO7KHILUVWFKDSWHUVDOVR SURYLGHDVROLGLQWURGXFWLRQWRWKH1,(/9,6SODWIRUPDQGWKHXVHRI1,/DE9,(:YLUWXDO LQVWUXPHQWDWLRQ  &KDSWHUVFDQEHFRYHUHGLQDQ\RUGHUKRZHYHULWLVLPSHUDWLYHWKDWDOOVWXGHQWVFRPSOHWHWKH ILUVWIRXUFKDSWHUVEHIRUHSURFHHGLQJWRWKHVXEVHTXHQWFKDSWHUV  • &KDSWHULQWURGXFHVWKH1,(/9,6WHVWHTXLSPHQW • &KDSWHULQWURGXFHVWKH(PRQD'$7([H[SHULPHQWDODGGLQPRGXOH • &KDSWHULQWURGXFHVWKH'$7([6RIW)URQW3DQHOFRQWURODQG • &KDSWHULQWURGXFHVWKHFRQFHSWRIPDWKHPDWLFDOPRGHOLQJXVLQJHOHFWURQLFIXQFWLRQDOEORFNV  ,QRUGHUWRPDNHWKHVWXGHQW VOHDUQLQJH[SHULHQFHPRUHPHPRUDEOHWKHVWXGHQWLVXVXDOO\DEOHWR ERWKYLHZVLJQDOVRQWKH1,(/9,6RVFLOORVFRSHDQGWKHQOLVWHQWRWKHLURZQYRLFHXQGHUJRLQJWKH PRGXODWLRQRUFRGLQJEHLQJLQYHVWLJDWHG  0DNLQJ0LVWDNHVDQG0LVZLULQJ $QLPSRUWDQWIDFWRUZKLFKPDNHVWKHOHDUQLQJH[SHULHQFHPRUHYDOXDEOHIRUWKHVWXGHQWLVWKDW WKHVWXGHQWLVDOORZHGWRPDNHZLULQJPLVWDNHV'$7([LQSXWVDQGRXWSXWVFDQEHFRQQHFWHGLQDQ\ FRPELQDWLRQZLWKRXWFDXVLQJGDPDJH$VWKHVWXGHQWEXLOGVWKHH[SHULPHQWWKH\QHHGWRPDNH FRQVWDQWREVHUYDWLRQVDGMXVWPHQWVDQGFRUUHFWLRQV,IVLJQDOVDUHQRWDVH[SHFWHGWKHQWKH VWXGHQWQHHGVWRPDNHDGHFLVLRQDVWRZKHWKHUWKHFRUUHFWLRQUHTXLUHGLVDQDGMXVWPHQWRUDQ LQFRUUHFWO\SODFHGSDWFKLQJZLUH  6WUXFWXUHRIWKH([SHULPHQWVDQG7RSLFV (DFKH[SHULPHQWLQWKH'$7([/DE0DQXDOSURYLGHVDEDVLFLQWURGXFWLRQWRWKHWRSLFXQGHU LQYHVWLJDWLRQIROORZHGE\DVHULHVRIFDUHIXOO\JUDGHGKDQGVRQDFWLYLWLHV$WWKHFRQFOXVLRQRI HDFKVXEVHFWLRQWKHVWXGHQWLVDVNHGWRDQVZHUTXHVWLRQVWRFRQILUPWKHLUXQGHUVWDQGLQJRIWKH ZRUNEHIRUHSURFHHGLQJ   ,QWURGXFWLRQ‹(PRQD,QVWUXPHQWV3W\/WG iii ,WVKRXOGEHQRWHGWKDWWKH'$7([DGGLQPRGXOHFDQLPSOHPHQWPDQ\PRUHH[SHULPHQWVWKDQDUH GRFXPHQWHGLQWKLV9ROXPH2QH/DE0DQXDODQGIXUWKHUH[SHULPHQWVZLOOEHUHOHDVHGLQODWHU PDQXDOV  )LQDOO\VLQFHWKH(777UDLQHULVDWUXHPRGHOLQJV\VWHPWKHLQVWUXFWRUKDVWKHIUHHGRPWR PRGLI\H[LVWLQJH[SHULPHQWVRUHYHQFUHDWHFRPSOHWHO\QHZH[SHULPHQWVWRFRQYH\QHZDQGFRXUVH VSHFLILFFRQFHSWVWRVWXGHQWV   LY  ‹(PRQD,QVWUXPHQWV3W\/WG,QWURGXFWLRQ +RZWRLQVWDOODQGSRZHUXS'$7([ŒZLWK1,(/9,6,, +DQGOLQJ'$7([ :KHQKROGLQJ'$7([DOZD\VKROG WKHFLUFXLWERDUGE\WKHHGJHVDV LOOXVWUDWHG         +ROG'$7([E\WKHHGJHV  +RZQRWWRKROG'$7([ (QVXUH1,(/9,6,,3URWRW\SH%RDUG3RZHU2)) %HIRUHLQVWDOOLQJWKH'$7([DGGLQPRGXOHLQWKH 1,(/9,6,,352727<3(3&,6/27DOZD\VFKHFNWKH 352727<3,1*%2$5'32:(5VZLWFKLVLQWKH 2))SRVLWLRQ       (QVXUH3URWRW\SH%RDUG3RZHULV2)) ,QVWDOOLQJ'$7([RQ 1,(/9,6,, :KHQLQVWDOOLQJWKH'$7([ DGGLQPRGXOHLQWKH1, (/9,6,,352727<3( 3&,6/27DOZD\VFDUHIXOO\ FKHFNWKHDOLJQPHQWLV FRUUHFWEHIRUHSXVKLQJ '$7([LQWRSRVLWLRQ     &DUHIXOO\DOLJQ'$7([ZLWKWKH 1,(/9,6VRFNHW  &DUHIXOO\SXVK'$7([LQWRSRVLWLRQ  &KHFNIRUFRUUHFWEUDFNHWDOLJQPHQW 3RZHUXS'$7([ $IWHU'$7([LVFRUUHFWO\SRVLWLRQHGWXUQWKH1, (/9,6,,3URWRW\SLQJ%RDUG3RZHUVZLWFK21       7XUQ1,(/9,63URWRW\SH%RDUG3RZHU21  ,QWURGXFWLRQ‹(PRQD,QVWUXPHQWV3W\/WG v  %HIRUHUHPRYLQJ'$7([ŒIURPWKH1,(/9,6,, (QVXUH1,(/9,6,,3URWRW\SH%RDUG3RZHULV2)) %HIRUHUHPRYLQJWKH'$7([DGGLQPRGXOHIURPWKH1, (/9,6,,352727<3(3&,6/27DOZD\VWXUQWKH 352727<3,1*%2$5'32:(5VZLWFK2))                   YL   (QVXUH3URWRW\SH%RDUG3RZHULV2)) EHIRUHUHPRYLQJ'$7([ ‹(PRQD,QVWUXPHQWV3W\/WG,QWURGXFWLRQ +RZWRLQVWDOODQGSRZHUXS'$7([ŒIRU1,(/9,6, +DQGOLQJ'$7([ :KHQKROGLQJ'$7([DOZD\VKROG WKHFLUFXLWERDUGE\WKHHGJHVDV LOOXVWUDWHG          +ROG'$7([E\WKHHGJHV +RZQRWWRKROG'$7([ (QVXUH1,(/9,6,3URWRW\SH%RDUG3RZHU2)) %HIRUHLQVWDOOLQJWKH'$7([DGGLQPRGXOHLQWKH 1,(/9,6,352727<3(3&,6/27DOZD\VFKHFNWKH 352727<3,1*%2$5'32:(5VZLWFKLVLQWKH 2))SRVLWLRQ        (QVXUH3URWRW\SH%RDUG3RZHULV2)) ,QVWDOOLQJ'$7([RQ 1,(/9,6, :KHQLQVWDOOLQJWKH'$7([ DGGLQPRGXOHLQWKH1, (/9,6,352727<3(3&, 6/27DOZD\VFDUHIXOO\ FKHFNWKHDOLJQPHQWLV FRUUHFWEHIRUHSXVKLQJ '$7([LQWRSRVLWLRQ     &DUHIXOO\DOLJQ'$7([ZLWKWKH 1,(/9,6,VRFNHW  &DUHIXOO\SXVK'$7([LQWRSRVLWLRQ  &KHFNIRUFRUUHFWEUDFNHWDOLJQPHQW 3RZHUXS'$7([ $IWHU'$7([LVFRUUHFWO\SRVLWLRQHGWXUQWKH1, (/9,6,3URWRW\SLQJ%RDUG3RZHUVZLWFK21       7XUQ1,(/9,6,3URWRW\SH%RDUG3RZHU21  ,QWURGXFWLRQ‹(PRQD,QVWUXPHQWV3W\/WG vii %HIRUHUHPRYLQJ'$7([ŒIURPWKH1,(/9,6, (QVXUH1,(/9,6,3URWRW\SH%RDUG3RZHULV2)) %HIRUHUHPRYLQJWKH'$7([DGGLQPRGXOHIURPWKH1, (/9,6,352727<3(3&,6/27DOZD\VWXUQWKH 352727<3,1*%2$5'32:(5VZLWFK2))            YLLL   (QVXUH3URWRW\SH%RDUG3RZHULV2)) EHIRUHUHPRYLQJ'$7([ ‹(PRQD,QVWUXPHQWV3W\/WG,QWURGXFWLRQ  (6':DUQLQJ²(6'6HQVLWLYH3URGXFW  &DXWLRQ$OWKRXJKWKLVSURGXFWKDVEHHQGHVLJQHGWREHDVUREXVWDVSRVVLEOH(6' (OHFWURVWDWLF'LVFKDUJH FDQGDPDJHRUXSVHWWKLVSURGXFW7KLVSURGXFWPXVWEH SURWHFWHGDWDOOWLPHVIURP(6'6WDWLFFKDUJHVPD\HDVLO\SURGXFHSRWHQWLDOVRI VHYHUDONLORYROWVRQWKHKXPDQERG\RUHTXLSPHQWZKLFKFDQGLVFKDUJHZLWKRXW GHWHFWLRQ,QGXVWU\VWDQGDUG(6'SUHFDXWLRQVPXVWEHHPSOR\HGDWDOOWLPHV  7KH(PRQD(77ERDUGLVGHVLJQHGDQGLQWHQGHGIRUXVHDVDQH[SHULPHQWDO SODWIRUPIRUKDUGZDUHRUVRIWZDUHLQDQHGXFDWLRQDOSURIHVVLRQDOODERUDWRU\ HQYLURQPHQW7RIDFLOLWDWHXVDJHWKHERDUGLVPDQXIDFWXUHGZLWKLWVFRPSRQHQWVDQG FRQQHFWLQJWUDFHVRSHQO\H[SRVHGWRWKHRSHUDWRUDQGWKHHQYLURQPHQW$VDUHVXOW (6'VHQVLWLYH (6'6 FRPSRQHQWVRQWKHERDUGVXFKDVWKHVHPLFRQGXFWRU LQWHJUDWHGFLUFXLWVFDQEHGDPDJHGZKHQH[SRVHGWRDQ(6'HYHQW7RLQGLFDWHWKH (6'VHQVLWLYLW\RIWKH(PRQD(77ERDUGLWFDUULHVWKHV\PEROVKRZQDWOHIW  8QSDFNLQJ7UDQVSRUWLQJDQG6WRUDJH :KHQXQSDFNLQJWKH(PRQD(77ERDUGIURPLWVVKLSSLQJFDUWRQGRQRWUHPRYHWKHERDUG IURPWKHDQWLVWDWLFSDFNDJLQJPDWHULDOXQWLO\RXDUHUHDG\WRFRPSOHWHWKHLQVWDOODWLRQ%HIRUH XQZUDSSLQJWKHDQWLVWDWLFSDFNDJLQJGLVFKDUJH\RXUVHOIE\WRXFKLQJDJURXQGHGEDUHPHWDO VXUIDFHWRXFKLQJDQDSSURYHGDQWLVWDWLFPDWRUZHDULQJDQ(6'VWUDS:KHQWUDQVSRUWLQJRU VWRULQJWKH(PRQD(77ERDUGILUVWSODFHLWLQDQDQWLVWDWLFFRQWDLQHURUSDFNDJLQJ  +DQGOLQJDQG6HWXS +DQGOLQJWKH(PRQD(77ERDUGFDQGDPDJHWKHERDUGFRPSRQHQWVLI(6'SUHYHQWLRQ PHDVXUHVDUHQRWDSSOLHG%HIRUHKDQGOLQJRUVHWXSHTXDOL]H\RXUSRWHQWLDOZLWKWKHERDUGE\ WRXFKLQJRQHRIWKHLQWHJUDWHG(6'GLVFKDUJHSDGV'XULQJDOOKDQGOLQJDQGVHWXS(6'SUHYHQWLRQ PHDVXUHVPXVWEHDSSOLHG,QDGGLWLRQWKH(PRQD(77ERDUGVKRXOGEHKDQGOHGE\WKHHGJHV 7RXFKLQJH[SRVHGFLUFXLWVFRPSRQHQWVRUFRQQHFWRUVFRXOGUHVXOWLQDQ(6'HYHQW:KHQVHWWLQJ XS(PRQD(77ERDUGREVHUYHWKHIROORZLQJJXLGHOLQHVWRPLQLPL]HWKHSRWHQWLDOLPSDFWRI (6'  ‡3DWFKWKHGHVLUHGH[SHULPHQWEORFNVXVLQJPPSDWFKFRUGV ‡6HWVZLWFKHVDQGRWKHUFRQWUROVWRLQLWLDOVHWWLQJV ‡(QVXUHWKH1,(/9,6LVSRZHUHGFRUUHFWO\E\SOXJJLQJWKH1,(/9,6$&'&SRZHUVXSSO\EULFN LQWRDQDSSURSULDWH$&RXWOHW ‡0RYHWKHERDUGSRZHUVZLWFK21  2SHUDWLRQ :KHQRSHUDWLQJWKH(PRQD(77ERDUG(6'FDQFDXVHXSVHWDVZHOODVGDPDJHWRWKHERDUG FRPSRQHQWV7KHUHIRUHDSSO\(6'SUHYHQWLRQPHDVXUHVZKHQHYHURSHUDWLQJWKH(PRQD(77 ERDUG,QDGGLWLRQREVHUYHWKHIROORZLQJJXLGHOLQHV  ‡'RQRWWRXFKH[SRVHGWUDFHVRUFRPSRQHQWVRQWKHERDUGZKLOHWKHERDUGLVSRZHUHGRQ ‡([HUFLVHFDXWLRQZKHQPDQLSXODWLQJVZLWFKHVEXWWRQVNQREVDQGRWKHUFRQWUROVZKLOHWKHERDUG LVSRZHUHGRQ  ,QWURGXFWLRQ‹(PRQD,QVWUXPHQWV3W\/WG ix (6'3UHYHQWLRQ0HDVXUHV (6'SUHYHQWLRQPHDVXUHVIRFXVRQUHGXFLQJRUHOLPLQDWLQJWKHEXLOGXSRIVWDWLFFKDUJHWKDWPD\ UHVXOWLQDQ(6'HYHQWWKDWFRXOGGDPDJHRUXSVHWVHQVLWLYHHOHFWURQLFV7RPLQLPL]HWKHSRWHQWLDO IRUDQ(6'HYHQWLPSOHPHQWWKHIROORZLQJPHDVXUHV  ‡3HUIRUPDOOZRUNDWDQDSSURYHGZRUNVWDWLRQ ‡8VHDQDSSURYHGDQWLVWDWLFPDWWRFRYHU\RXUZRUNVXUIDFH ‡:HDUDFRQGXFWLYHZULVWVWUDSDWWDFKHGWRWKHDQWLVWDWLFPDWDQGDJRRGHDUWKJURXQG ‡%HIRUHKDQGOLQJRUEHJLQQLQJZRUNHTXDOL]H\RXUSRWHQWLDOZLWKWKHERDUGE\WRXFKLQJRQHRIWKH ´*1'µSDGV         [  ‹(PRQD,QVWUXPHQWV3W\/WG,QWURGXFWLRQ    $QLQWURGXFWLRQWRWKH1,(/9,6,,WHVWHTXLSPHQW &ODVV 1DPH   ([SHULPHQW²$QLQWURGXFWLRQWRWKH1,(/9,6,,WHVWHTXLSPHQW 3UHOLPLQDU\GLVFXVVLRQ 7KHGLJLWDOPXOWLPHWHUDQGRVFLOORVFRSHDUHSUREDEO\WKH WZRPRVWXVHGSLHFHVRIWHVWHTXLSPHQWLQWKH HOHFWURQLFVLQGXVWU\7KHEXONRIPHDVXUHPHQWVQHHGHG WRWHVWDQGRUUHSDLUHOHFWURQLFVV\VWHPVFDQEH SHUIRUPHGZLWKMXVWWKHVHWZRGHYLFHV  $WWKHVDPHWLPHWKHUHZRXOGEHYHU\IHZHOHFWURQLFV ODERUDWRULHVRUZRUNVKRSVWKDWGRQ·WDOVRKDYHD'& 3RZHU6XSSO\DQG)XQFWLRQ*HQHUDWRU$VZHOODV JHQHUDWLQJ'&WHVWYROWDJHVWKHSRZHUVXSSO\FDQEH XVHGWRSRZHUWKHHTXLSPHQWXQGHUWHVW7KHIXQFWLRQ JHQHUDWRULVXVHGWRSURYLGHDYDULHW\RI$&WHVWVLJQDOV  ,PSRUWDQWO\1,(/9,6,,KDVWKHVHIRXUHVVHQWLDOSLHFHVRIODERUDWRU\HTXLSPHQWLQRQHXQLW DQGRWKHUV +RZHYHULQVWHDGRIHDFKKDYLQJ ...
Purchase answer to see full attachment

Tutor Answer

jackmiller1
School: Duke University

Here you go! L...

flag Report DMCA
Review

Anonymous
Thank you! Reasonably priced given the quality not just of the tutors but the moderators too. They were helpful and accommodating given my needs.

Similar Questions
Hot Questions
Related Tags
Study Guides

Brown University





1271 Tutors

California Institute of Technology




2131 Tutors

Carnegie Mellon University




982 Tutors

Columbia University





1256 Tutors

Dartmouth University





2113 Tutors

Emory University





2279 Tutors

Harvard University





599 Tutors

Massachusetts Institute of Technology



2319 Tutors

New York University





1645 Tutors

Notre Dam University





1911 Tutors

Oklahoma University





2122 Tutors

Pennsylvania State University





932 Tutors

Princeton University





1211 Tutors

Stanford University





983 Tutors

University of California





1282 Tutors

Oxford University





123 Tutors

Yale University





2325 Tutors